SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014119518.1.66763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014119518.1.66763
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily YjgF-like 7.07e-33
Family YjgF/L-PSP 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014119518.1.66763
Sequence length 116
Comment hypothetical protein [Oscillibacter valericigenes]; AA=GCF_000283575.1; RF=representative genome; TAX=693746; STAX=351091; NAME=Oscillibacter valericigenes Sjm18-20; strain=Sjm18-20; AL=Complete Genome; RT=Major
Sequence
MNIQRYEGNGRMSKAVVAGQTIYFCGQTCRDGGDIRVQTSAVLKKIDDLLAACGSDKRHL
LMVQIFLKDMADFAGLNEVYDKWIEDGYEPARACVQATMAAPDILVEIVVTAAVAS
Download sequence
Identical sequences G4KXB2
WP_014119518.1.66763 gi|350272118|ref|YP_004883426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]