SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014141536.1.70206 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014141536.1.70206
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.54e-27
Family ArsR-like transcriptional regulators 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014141536.1.70206
Sequence length 103
Comment transcriptional regulator [Streptomyces cattleya]; AA=GCF_000240165.1; RF=representative genome; TAX=1003195; STAX=29303; NAME=Streptomyces cattleya NRRL 8057 = DSM 46488; strain=DSM 46488; AL=Complete Genome; RT=Major
Sequence
MPTDVFGALANPVRRHLLDALRDGPRAVNDLVSEFELSRPAISEHLQVLRQAGLVREEPR
GRQRFYHLEPRRLEEVGDWLHPFERYWRGRLRSLAELLDEENP
Download sequence
Identical sequences F8JV56
gi|386354415|ref|YP_006052661.1| gi|357398380|ref|YP_004910305.1| WP_014141536.1.28582 WP_014141536.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]