SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014142886.1.28582 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014142886.1.28582
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.62e-35
Family MarR-like transcriptional regulators 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014142886.1.28582
Sequence length 165
Comment MarR family transcriptional regulator [Streptomyces cattleya]; AA=GCF_000237305.1; RF=na; TAX=1003195; STAX=29303; NAME=Streptomyces cattleya NRRL 8057 = DSM 46488; strain=NRRL 8057; AL=Complete Genome; RT=Major
Sequence
MEDEVDRLVAAWRRERPDLDVEPLEVLSRVSRLARHLDRARRLAFSEHALEPWEFDVLTS
LRRAGLPYQLSPGQLLTQTLVTSGTMTNRIDRLAKKGLVERLPDPSDRRGVLVRLTDEGR
DRADQALAGLLAQERAILAGLSAQERAALAALLRRLTAPFDNVPG
Download sequence
Identical sequences F8JZS3
gi|386355769|ref|YP_006054015.1| WP_014142886.1.28582 WP_014142886.1.70206 gi|357399730|ref|YP_004911655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]