SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014145982.1.28582 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014145982.1.28582
Domain Number 1 Region: 15-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.4e-31
Family HxlR-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014145982.1.28582
Sequence length 153
Comment transcriptional regulator [Streptomyces cattleya]; AA=GCF_000237305.1; RF=na; TAX=1003195; STAX=29303; NAME=Streptomyces cattleya NRRL 8057 = DSM 46488; strain=NRRL 8057; AL=Complete Genome; RT=Major
Sequence
MADRPDHVTFQHGQAFLAAISERWNYQILREVFFGVHRFGELKRTLGISATMLTARLNDL
TELGLLEKRAYRADKPWFEYRLTDPARELVVPAVVAVTRWAETHADARPTDARPLLHTSC
GHRTEPYLACSSCHRPIEADTLEPLTPQDDGPS
Download sequence
Identical sequences F8K3V1
gi|357402845|ref|YP_004914770.1| gi|386358922|ref|YP_006057168.1| WP_014145982.1.28582 WP_014145982.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]