SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014165242.1.49381 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014165242.1.49381
Domain Number 1 Region: 215-408
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.09e-73
Family B3/B4 domain of PheRS, PheT 0.00000536
Further Details:      
 
Domain Number 2 Region: 44-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-42
Family Myf domain 0.0046
Further Details:      
 
Domain Number 3 Region: 480-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.09e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00091
Further Details:      
 
Domain Number 4 Region: 708-806
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.75e-30
Family Anticodon-binding domain of PheRS 0.001
Further Details:      
 
Domain Number 5 Region: 417-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000101
Family Domains B1 and B5 of PheRS-beta, PheT 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014165242.1.49381
Sequence length 806
Comment phenylalanine--tRNA ligase subunit beta [Flavobacterium columnare]; AA=GCF_001677395.1; RF=na; TAX=996; STAX=996; NAME=Flavobacterium columnare; strain=Pf1; AL=Complete Genome; RT=Major
Sequence
MKISYNWLKQFIKTDWSSEKTAELLTDLGLEVEGVEKFFSIKGGLEGLIVGHVLTCEKHP
NADKLKITTVDLGNGEPVQIVCGASNVAVGQKVIVATIGTKLYDKEGNSFEIKKGKIRGE
ESHGMICAEDEIGIGDSHEGIMVLDESIEVGTLASKVFNVEIDEVFEIGLTPNRADAMSH
WGVARDLRAGMLQQDISTELITPSVSSYKVEKRTLKIDVNVENTTLVPRYCGVTISDIKV
GTSPAWLQNRLKAIGLTPKNNIVDITNYVLHELGQPLHAFDASKIHGKIIVKNATEGEKF
ITLDDVERSLHKEDIMICDEKGPLCIAGVMGGKKSGVSERTTSIFLESAYFNPVSVRKTA
KRHGINSDASFRFERGIDPTITEYALKRAAILICQIAGGEMTSDIMEVYPKKIEDFPVFL
NLEKVKKIIGQEIPDEEIKNILVSLDIKVNSISKVGLGLTVPAYRVDVTREIDVIEEILR
VYGYNNIQFSQKLNATTAHSSKTEDYKVQNIVANLLVGNGFNEMMANSLTSPNYVNLSNS
LHEKNNVLMLNPLSNDLSAMRQSMLFSALEAVSFNINRKNADLRLFEFGKTYHKQLAGHE
EKMHLTLTMSGNRSKESWTNAQRPSDFFQFKGYILNIFERLGIKNIVTMPMKSDIFSEGM
IYELGASSLVEFGTIKKSILKHFDIKQEVFFADFNWNAILKHLSTNVKFIEISKYPEVRR
DLALLVDEHIEFEKILDLANKTEKNLLKRVDLFDVYQGNNLPEGKKSYAISFLLQDSTKT
LTDSQIDKVMSKLTQNFETELGATLR
Download sequence
Identical sequences A0A1V2YTC3 G8XAA6
WP_014165242.1.48360 WP_014165242.1.49381 WP_014165242.1.70420 WP_014165242.1.85295 gi|365960190|ref|YP_004941757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]