SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014165323.1.70420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014165323.1.70420
Domain Number 1 Region: 6-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-54
Family PP-loop ATPase 0.0000169
Further Details:      
 
Domain Number 2 Region: 344-431
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000759
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.039
Further Details:      
 
Weak hits

Sequence:  WP_014165323.1.70420
Domain Number - Region: 262-300
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0265
Family Myb/SANT domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014165323.1.70420
Sequence length 435
Comment tRNA(Ile)-lysidine synthetase [Flavobacterium columnare]; AA=GCF_000240075.2; RF=representative genome; TAX=1041826; STAX=996; NAME=Flavobacterium columnare ATCC 49512; strain=ATCC 49512; AL=Complete Genome; RT=Major
Sequence
MLIQLQNHINQNLPFLNDKKLLLAVSGGIDSMILLNLFSKLNLQIAIAHCNFQLRGDESN
KDEEFVKFESQKLKVESFIKNFETQIYANDNKLSIQQAARELRYNWFYELLNTQGFDHLL
TAHHLDDSLETFLINFTRGTGIEGLTGIPQINDKIIRPLLIFSREEIEKYAAENNIQWRE
DASNASDKYFRNKIRHHVVPILKELNTNLLSSFQNTLKNLKQTESLASHSIYNKLEEIAI
KKEDDIYFDVVKLQTLPNYKAYLYEWLKSYGFHDWDAIYDLVENQSGKQILSDHYRLIKD
RNILILTKKQTSLTLEFFISKETKYIENPIKLRFCNSGYNTIPTKSSIFVNKETLKFPLK
LRKWQKGDYFYPSGMKGKKKISKYFKDEKFSLVDKEDTWLLLSDDKIVWVINHRADNRFI
AHSNTKNILNIIFTE
Download sequence
Identical sequences G8XB76
gi|365960270|ref|YP_004941837.1| WP_014165323.1.70420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]