SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014168006.1.21139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014168006.1.21139
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.44e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014168006.1.21139
Sequence length 100
Comment MULTISPECIES: molecular chaperone TorD [Enterobacter]; AA=GCF_001750725.1; RF=na; TAX=299767; STAX=299767; NAME=Enterobacter ludwigii; strain=EN-119; AL=Complete Genome; RT=Major
Sequence
MIALEEAVMEIIVNAGQSRSLCFEALHAARQGNLDEAKSLLREADGYARQAHKMQTKLIE
QDAGEARQPMTLIMVHAQDHLMNSLLARELSEEIIHLYQR
Download sequence
Identical sequences A0A0E2M6A1 A0A0G4BD09 A0A155MIS3 G8LEX1
WP_014168006.1.10612 WP_014168006.1.13522 WP_014168006.1.15096 WP_014168006.1.20346 WP_014168006.1.21139 WP_014168006.1.2196 WP_014168006.1.21963 WP_014168006.1.24084 WP_014168006.1.27882 WP_014168006.1.40582 WP_014168006.1.40638 WP_014168006.1.40945 WP_014168006.1.49197 WP_014168006.1.57391 WP_014168006.1.64616 WP_014168006.1.75814 WP_014168006.1.79393 WP_014168006.1.86083 WP_014168006.1.88986 WP_014168006.1.89102 WP_014168006.1.91166 WP_014168006.1.92699 WP_014168006.1.9451 WP_014168006.1.98015 WP_014168006.1.98207 WP_014168006.1.98616 gi|365968353|ref|YP_004949914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]