SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014181976.1.9551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014181976.1.9551
Domain Number 1 Region: 8-139
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.98e-18
Family N-acetyl transferase, NAT 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014181976.1.9551
Sequence length 149
Comment N-acetyltransferase [Streptomyces bingchenggensis]; AA=GCF_002154605.1; RF=na; TAX=476552; STAX=476552; NAME=Streptomyces milbemycinicus; strain=NRRL 5739; AL=Scaffold; RT=Major
Sequence
MGFILEGPVLEGGLVRLEPLEHRHAADLAVAADEDRSSYRFTWVPTAAEVEGYIDAQLAR
AAAGKLAPYAQVDRVSGRAVGATAYWDPRLWPQGEGLSAIEVGFTWLAPSAQGSGMNTEA
KYLLFRHAFENWGVARLMVRDPSGRSTSL
Download sequence
Identical sequences D7C7I1
gi|374992165|ref|YP_004967660.1| WP_014181976.1.69245 WP_014181976.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]