SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014185521.1.78142 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014185521.1.78142
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.49e-24
Family YheA-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014185521.1.78142
Sequence length 141
Comment YlbF family regulator [Desulfosporosinus orientis]; AA=GCF_000235605.1; RF=representative genome; TAX=768706; STAX=1563; NAME=Desulfosporosinus orientis DSM 765; strain=DSM 765; AL=Complete Genome; RT=Major
Sequence
MTNEIFEKAQLLADAIARSEELAELHSKEDAMAADPSAQVLIAELQKAQERFMEAQQNGE
EPSEADKLAVDEIETKVEANPAIAAYMEAQDKFTEMLDGVNAILAGAIANASDSCSCGDS
GCDPSGCNPGGCGSSGCGCGA
Download sequence
Identical sequences G7W972
gi|374995729|ref|YP_004971228.1| WP_014185521.1.78142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]