SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014242789.1.66676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014242789.1.66676
Domain Number 1 Region: 165-545
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.99e-80
Family beta-Lactamase/D-ala carboxypeptidase 0.00032
Further Details:      
 
Domain Number 2 Region: 47-212
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.22e-38
Family Penicillin binding protein dimerisation domain 0.0017
Further Details:      
 
Domain Number 3 Region: 582-633
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014242789.1.66676
Sequence length 639
Comment penicillin-binding protein [Halobacteriovorax marinus]; AA=GCF_000210915.2; RF=representative genome; TAX=862908; STAX=97084; NAME=Halobacteriovorax marinus SJ; strain=SJ; AL=Complete Genome; RT=Major
Sequence
MESSKTKIKISFFVFLALFSAILVKAFIVQVVDKEILLTKAKKQFFRERTTYPKRGNILD
RNGNPLAINVQTYSIFTIPKNLKGDYSTYKKVSKIVPSLTYEKILSIIKKRKKFTFLARK
IELTSEQVQQLKDLKGVHIEAVAKRFYPNHELSSQTIGFVGIDNVGLSGIEYAFDEQLRG
KPKITKYVIDRKGRPIKFESTQVGSGAQDVVLSIDKDLQSIAEKALKDTVEEFGAIRGGF
GVMNSETGEILAMGNYPNFDPNYPHRSPSKYKKLAFITDPFEPGSTFKALTIASALEHKI
ARPDTNYYCEHGKLRVEGHTISEAEAKKKFEWLSVTEILQHSSNVGTTKIAFDLTYPKLK
ETLKKFSIGEKTGIELAGESRGIFNDEENVSPLSLSNISFGQGVATTGVQMLAAYSAISN
GGYYIKPTILKREKSQIKEEDKWQIIDFQTSRELKEMLVQAVEDGTGGRARIPYFTIAGK
TSTAQRSDNTGGYSGYIPGFLGFPIGTKDKFTVYVYVDKPAKGKSYYGGTVAGPVFKKIA
QYILYKDRNLGNVAVKKKFNAKNSFDTVKVKHSSTRIIKGGVPNFSGLDKKSANKLARKL
GLKIIHNGIGVVSSQSPEIGVKVDNDTIVRLYYQPPKYE
Download sequence
Identical sequences E1X244
WP_014242789.1.66676 gi|374286888|ref|YP_005033973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]