SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014257856.1.38130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014257856.1.38130
Domain Number 1 Region: 579-1038
Classification Level Classification E-value
Superfamily ALDH-like 1.02e-127
Family ALDH-like 0.000000337
Further Details:      
 
Domain Number 2 Region: 190-531
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.8e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000292
Further Details:      
 
Domain Number 3 Region: 17-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 9.42e-62
Family N-terminal domain of bifunctional PutA protein 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014257856.1.38130
Sequence length 1039
Comment bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Vibrio furnissii]; AA=GCF_000184325.1; RF=na; TAX=903510; STAX=29494; NAME=Vibrio furnissii NCTC 11218; strain=NCTC 11218; AL=Complete Genome; RT=Major
Sequence
MFTATDVLKAEFVEQPLSKLWSQISPLYMVDESQWLKQLLPLATPSDAEKSSMAVKTTEL
IEAIRRDKKSIQMIDALLLEYSLDTQEGILLMCLAEALMRIPDTETADAFIRDRLGVADW
KSHLKNSDSVFVNASTWGLMLTGKVVGLADAEGTSPVQAVNRLVNKLSEPVIRKAMHQAM
KIMGHQFVLGRTIAEAQKNGRTMRDKGYTYSFDMLGEAALTTADANKYFKDYLMAIEAVG
RDKYGLDTSPAPSVSIKLSALHPRYEVANRDRVMTELHDTLIQLLERAMELDVAITIDAE
EADRLELSLELFEKVYRHEKVAGWGKFGLVIQAYSKRALPVLAWLTALAKDQGDLIPVRL
VKGAYWDSEIKWSQQSGYTGYPVYTRKEATDVSYLACARFLLSESVRGNLFPQFASHNAQ
TVTAIAVMAQHKDFEFQRLHGMGDALYNQVMAAYKQSVRIYAPVGSHKDLLPYLVRRLLE
NGANSSFVHRLVDARCPINTLTQHPVDMLLAFDTLNNTKIPLPTHIFPERSNSYGVNIDI
ESEAKPFEEQVNAFLSKQWQASPIINGEIQFESMIKAAAQPELVKAPYDRRIEVGQIFHA
NHDHVSAAIETAHAAFAAWNQAPAQARGEKLDKLADLLEANLAELVAICHQEAGKTIHDS
IDEVREAVDFCRYYAKRIDTLGQFSIDGFDGQSRQVARQGRGVFVCISPWNFPLAIFLGQ
ITAALVAGNTVVAKPAEQTSLIAARAVELMLEAGFPSGVIQLLPGRGSQIGTALTSHPAI
AGVAFTGSTATAQRINQTLAERDADPVPFIAETGGQNAMIVDSTALPEQVVRDVLRSAFA
SAGQRCSALRVLYVQQDIADRIITLIQGAMQELSVGTPYLHSTDVGPVIDTKAKQGLLAH
IERMTQTQKKVAQLELGEACEHGDFVAPTAFEISGIDCLTEEQFGPILHIVRFKASELAN
VVQQINETGFGLTMGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGT
GPKAGGPHYLYRFTQVQYS
Download sequence
Identical sequences F0LZ19
gi|375133080|ref|YP_005049488.1| WP_014257856.1.38130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]