SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014266408.1.98070 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014266408.1.98070
Domain Number 1 Region: 7-363
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 7.32e-86
Family Homocysteine S-methyltransferase 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014266408.1.98070
Sequence length 366
Comment 5-methyltetrahydrofolate--homocysteine methyltransferase [Granulicella mallensis]; AA=GCF_000178955.2; RF=representative genome; TAX=682795; STAX=940614; NAME=Granulicella mallensis MP5ACTX8; strain=MP5ACTX8; AL=Complete Genome; RT=Major
Sequence
MTKAHQHPLEKILESRIAIIDGAMGTTIRTYGMTEADIRGERFKDSKKDLLNNGDLFSLT
QPKMICDIHRRFLEAGADIIETNTFGATGITQSEFFVDDPREHGGRKDPEFYQKIIEDKF
LNDLAWEINEQSARQCREWADRTANETGRQRFVAGAIGPLTVSLSNSPDADDSGFRVVTF
DQVKAAYVQQVRALIAGGSDLLLVETIFDSLNAKAALVAIREVFDQDGLTSNNKELPVMI
SAAVGRGGETLISAQTTEAFWNAVQHVKPLSVGLNCSLGPDLMYPFLEELSEKADVAISC
YPNAGLPNPLSETGFDLGPQDMARYLGDFARGGLINIAGGCCGNTPEHIAAIAKALDGKA
PRELGA
Download sequence
Identical sequences G8NTX8
WP_014266408.1.98070 gi|374312134|ref|YP_005058564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]