SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014266567.1.98070 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014266567.1.98070
Domain Number 1 Region: 5-384
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.31e-100
Family Homocysteine S-methyltransferase 0.00000447
Further Details:      
 
Domain Number 2 Region: 334-622
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.75e-66
Family Methylenetetrahydrofolate reductase 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014266567.1.98070
Sequence length 627
Comment bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase [Granulicella mallensis]; AA=GCF_000178955.2; RF=representative genome; TAX=682795; STAX=940614; NAME=Granulicella mallensis MP5ACTX8; strain=MP5ACTX8; AL=Complete Genome; RT=Major
Sequence
MAVGIDRLFAGGTVLCDGAMGTMLYSCGVFINRCYDELNLSQPEMVRSVHQQYLQAGAEV
IETNTFGANSFRLERFALREKVREFNLAGAAIARQSVDAIREKQGTEAFVAGAVGPLGVR
LEPLGKLSLEEAREAFAEQISALAEGGVDLIIIETMMSIDEAEQAVLAARQVAPHLKVAV
MVTVDEDGNCLDGTSPEVAAERLTAVGADAIGCNCSSGPATVLTVIERMREATALPLLAM
PNAGMPRNVEGRNIYLTSPEYMASFVRKAVRAGASWVGGCCGTTPAHIRAMRGSLRAMDA
QESGERATEHTPHIVHASESEHRVEPRPLGERSQIGRMIADGEFVTMVEIVPPKGFDCSK
ELAGALLMKKRGVHVINVPDSPRASARMGAQSLCVQIQQQVGIETILHYTCRDRNVLSMQ
SDLLGASSIGLKNILCLTGDPPKMGNYPDATAVFDVDAIGLVNIVHGLNQGLDIGRNPIG
GSTGFTISVAANPGVPDIEHEVRRFAYKVEAGAEFCITQPVFDLRLLEDFLRRIEGFRIP
VIAGIWPLTSLRNAEFMKNDLRVAMPDEIFVRMAAAGGKEEALAEGLKIAQEMLASVRGS
VQGVQVSAPFGKYTAAAEVLGLTEEIA
Download sequence
Identical sequences G8NVM1
gi|374312293|ref|YP_005058723.1| WP_014266567.1.98070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]