SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014278409.1.37039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014278409.1.37039
Domain Number 1 Region: 17-404
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.98e-138
Family ArgJ-like 0.000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014278409.1.37039
Sequence length 408
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Paenibacillus terrae]; AA=GCF_000235585.1; RF=na; TAX=985665; STAX=159743; NAME=Paenibacillus terrae HPL-003; strain=HPL-003; AL=Complete Genome; RT=Major
Sequence
MSKSGFTVVNGGNIVTPRGFTAGGLHCGLKNTDRNDIGVIRCEVEATAAAVYTTNVFQAA
PLKVTRESLVDGRLQAVVVNSGNANACTGQQGEQDAYAMRSAAARELGIAESNVAVASTG
VIGEHLKMDRVLGGISALPGRVNGESDGAEQFTQAILTTDLVKKEACVAVEVDGVTIHIA
GAAKGSGMIHPNMATMLAFMTCDAAIGQTALHQLLKQATDTSFNMITVDGDTSTNDMLIA
MASGLAGNRELQAEHPDWAAFAEAFTYICRELAKAIARDGEGATKLVEVSVSGAVSDASA
QAIAKTVIGSSLVKSAVFGADANWGRIIAAVGRAGEPVNPDTVDIRLGDIVVLSASSPVA
FDEDEALSYLRGDTVRIIVDLHHGNGTATAWGCDLTYDYVRINAAYRT
Download sequence
Identical sequences G7VUP7
WP_014278409.1.37039 gi|374320748|ref|YP_005073877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]