SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014278693.1.37039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014278693.1.37039
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily SIS domain 3.24e-38
Family mono-SIS domain 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014278693.1.37039
Sequence length 185
Comment 6-phospho-3-hexuloisomerase [Paenibacillus terrae]; AA=GCF_000235585.1; RF=na; TAX=985665; STAX=159743; NAME=Paenibacillus terrae HPL-003; strain=HPL-003; AL=Complete Genome; RT=Major
Sequence
METSQYLSEVLKELQLVPQLINDEESEQLIQSITSANKVFVAGAGRSGFMIRSLAMRLMH
MGVQAYVVGETVTPGLGEGDLLIIGSGSGETKSLTSMAEKTKKLGASLALLTTSPGSTIG
KLADIIVRLPGAPKDPSNKDYQTIQPMGSLFEQTLLLYGDALVLRTMELRKLTSESMFGQ
HANLE
Download sequence
Identical sequences G7VZT1
WP_014278693.1.37039 gi|374321036|ref|YP_005074165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]