SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014282293.1.37039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014282293.1.37039
Domain Number 1 Region: 7-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-84
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Weak hits

Sequence:  WP_014282293.1.37039
Domain Number - Region: 503-565
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 435-488
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014282293.1.37039
Sequence length 759
Comment serine/threonine protein kinase [Paenibacillus terrae]; AA=GCF_000235585.1; RF=na; TAX=985665; STAX=159743; NAME=Paenibacillus terrae HPL-003; strain=HPL-003; AL=Complete Genome; RT=Major
Sequence
MIGHLLGGRYEIIERIGGGGMALVYRAQDILLNRNVAVKVLRQQFVHDDEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEIHYIVMECVEGKNLNEIIKERAPLQVDEAVRIASQICDA
LEHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVVTGEKSDLYSLGIVLYQMLTAQLPFLGESPISVALKHLQEEFEEPRKINPLIPQSV
ENVILKSMRKNPEERYQSADEMLKDLETCLLPGRRNESKLEFTHLDDEDQTRVIPAIKPQ
QMGMSSNGDDAPAQSGDSEKLQSKQTAKKSKKKPILWVTLVLVLLLCMGGVVYYVQNLLV
VPDVVVPNVVTKTEDQAKLLISQSGLSIKDPIKREYKDGVAPGVVFYQSYPEKSVVKKGT
EIELKVGIAKPLTPMPDVKGQSYDDAVKLLTSQQIKETQIQRNEQFSDKAEGTVLSQTPA
ANESFDKDIVQVVLTVSKGAATVKMPNLVGKTQKEAENEVKSAGLKVGSVKEEFSYEQGK
GKVTKQWPSEAGSDLPPNTEITFYVSTGYPPEAITLPFNVPVAPKEEGKNSKIRITYTDA
RGENQEWGSRTINTTQVFTINLLLAPNKDSVVSVYRDGQFVDTYPVSYIDAKNGTVTMPQ
IAPPAGTTPTDTPEGTSSQNGSGNGEQGNNVDTSNGGTGDDSNNHDGTDGNGEPSALAPE
AGSTGVTRGKFAVKHTIDSGNGKGLHKKQGEVIEAVKHQ
Download sequence
Identical sequences G7VVA6
WP_014282293.1.37039 gi|374324697|ref|YP_005077826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]