SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014285098.1.37980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014285098.1.37980
Domain Number 1 Region: 41-124
Classification Level Classification E-value
Superfamily TrpR-like 5.23e-18
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014285098.1.37980
Sequence length 147
Comment MULTISPECIES: Chromosomal replication initiator DnaA domain protein [Pseudovibrio]; AA=GCF_000236645.1; RF=na; TAX=911045; STAX=911045; NAME=Pseudovibrio sp. FO-BEG1; strain=FO-BEG1; AL=Chromosome; RT=Major
Sequence
MPRISEGEKDEMSRSPRLGSPVHSALLNKPLSAVDWMATGRVALAFGLKPEELHSASRGY
AKAARARQVSMYILHVCMGMTLSQAAAAFGRDRTTAAHACKVVEDLREDPRFDAVLSEIE
GQLSASVASARMHPAINAGGPSDVFTA
Download sequence
Identical sequences G8PMF0
WP_014285098.1.27339 WP_014285098.1.37095 WP_014285098.1.37980 gi|374330791|ref|YP_005080975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]