SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014341664.1.67156 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014341664.1.67156
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.97e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014341664.1.67156
Sequence length 115
Comment PTS N'-diacetylchitobiose transporter subunit IIA [Rahnella aquatilis]; AA=GCF_000735505.1; RF=na; TAX=745277; STAX=34038; NAME=Rahnella aquatilis CIP 78.65 = ATCC 33071; strain=ATCC 33071; AL=Contig; RT=Major
Sequence
MMDLDSIVETESEMQDLEEVVMGLIINSGQARSLAYAALRKAKEGDFEQAYAVMAQSKMA
LNEAHLVQTKLIEDDQGEGKTKVSLVLVHAQDHLMTSMLARELIAELIELHEKIK
Download sequence
Identical sequences H2J1C7
WP_014341664.1.67156 WP_014341664.1.74596 gi|379704008|ref|YP_005220382.1|NC_016835 gi|379704008|ref|YP_005220382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]