SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014375128.1.69969 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014375128.1.69969
Domain Number 1 Region: 2-277
Classification Level Classification E-value
Superfamily Aldolase 3.91e-44
Family HMGL-like 0.0001
Further Details:      
 
Domain Number 2 Region: 300-439
Classification Level Classification E-value
Superfamily post-HMGL domain-like 3.69e-31
Family Conserved carboxylase domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014375128.1.69969
Sequence length 493
Comment biotin carboxyl carrier protein [Blastococcus saxobsidens]; AA=GCF_000284015.1; RF=representative genome; TAX=1146883; STAX=138336; NAME=Blastococcus saxobsidens DD2; strain=DD2; AL=Complete Genome; RT=Major
Sequence
MADVELVDVSIRDGNQSLWGATGLRTAHIAQVAPLMERVGFRALDYSSSTAMGVAVRTHR
EDPWERLRLTRAAMPTTKLQFIGTGFRFISWQNSHPETMQLVYDRLVANGIDRVVVLDPM
HDMDAARETARRLKQAGVDEVIGALTFTISVVHDDAFYADLAGQFAADPNFDRVYVKDPA
GILTAERARTLLPAIVGRLGGMPLELHSHATIGLSPLTYSIAPELGVAVVQVGSGPLGNG
SSLPEARRTVANLREMGHRVDVDDRALGLVCDFLDGLAVAEELPAGQPQDFDAAFLHHQI
AGGVMTTTRRQLQEIGMEHRFEALVEEVGVVRAEMGHPIMVTPFPQMVVSQALFNVIGER
YATVPDQVIRYVLGSFGRPTAPIDPTVKDRILDRPRARELASEPPPPTPAELRKQFHPGI
SDEELLLRAHMPEDQVDAMLAAGPAPRHFNPSLAPVLTLLRELGSRTSVHDLAVTTPGLR
MSVRRASEGTSVA
Download sequence
Identical sequences H6RIN7
gi|379734758|ref|YP_005328264.1| WP_014375128.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]