SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014379987.1.95202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014379987.1.95202
Domain Number 1 Region: 405-423,463-707
Classification Level Classification E-value
Superfamily HAD-like 2.69e-53
Family Meta-cation ATPase, catalytic domain P 0.00032
Further Details:      
 
Domain Number 2 Region: 219-312
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.44e-21
Family Calcium ATPase, transduction domain A 0.0063
Further Details:      
 
Domain Number 3 Region: 168-216,314-423
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000017
Family Calcium ATPase, transmembrane domain M 0.035
Further Details:      
 
Weak hits

Sequence:  WP_014379987.1.95202
Domain Number - Region: 33-79
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00213
Family HMA, heavy metal-associated domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014379987.1.95202
Sequence length 751
Comment copper-translocating P-type ATPase [Mycobacterium intracellulare]; AA=GCF_000767485.1; RF=na; TAX=1299331; STAX=1767; NAME=Mycobacterium intracellulare 1956; strain=1956; AL=Complete Genome; RT=Major
Sequence
MTVVDDAVLPVVSDAGGRMRVVVPWVRANSRRAVAVEESVGRQHGVRAVHAYPHTGSVVV
WYSPRRCDRSAVLRAITEAAHIAENLIPARSPRSADVRNTEVLRMVIGGAALALLGVRRY
GFKRPPLLSPTGQLVATGVTIFTGYPFLRGALRSLRSGRAGTDALVAAATVASLVLRENV
VALTVLWLLNIGEYLQDLTVRRTRRAISELLRGTADTAWIRLNDGSEVQVSIDTVEIGDQ
VVVHDHVAIPVDGEVIDGEAIVDQSAITGENLPVSITAGSPVHAGSVVVRGRLVVRASAV
GSQTVIGRIITRVEEAQLDRAPIQTVGENFSRRFVPASFILSALTLVLTGDVRRAMTMLL
IACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLERAGRVDAMVFDKTGTLTVGRPVVT
NIIALHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRITIPPHEECEVLVGLGMRT
WADGRILLLGSPSLLRDERVRISKKATEWVDTLRRQAETPLLLAVDGKLVGLISLRDEVR
PEAAEVLKRLRATGIRRIVMLTGDHPETAAAVANELGIEEWRAEVLPDDKLEVVKALQDE
GYVVGMVGDGVNDAPALATADIGIAMGLAGTDVAVETADVALANDNLQRLLDVPDLGARA
VEVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNASSVAVATNSSRLIRYRLSDTAL
GNAGDRDTNTEGSLPLPGGSVRPLVAQESSR
Download sequence
Identical sequences H8IWL8
gi|379747044|ref|YP_005337865.1| WP_014379987.1.3602 WP_014379987.1.95202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]