SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014380750.1.95202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014380750.1.95202
Domain Number 1 Region: 15-223
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0000157
Family Heme-dependent catalases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014380750.1.95202
Sequence length 227
Comment MULTISPECIES: hypothetical protein [Mycobacterium avium complex (MAC)]; AA=GCF_000767485.1; RF=na; TAX=1299331; STAX=1767; NAME=Mycobacterium intracellulare 1956; strain=1956; AL=Complete Genome; RT=Major
Sequence
MNVFDLVALPFQWGSAIRGKRIFHPSGVLARGFIERIAPAGQGLPIPSSEIVARVSKASG
TPGALPDFVGLAFRLTPPEPAGKPWDILLVSAGSGVLSRAVALRPTASWNGQTLTTLMPL
HYQNHNWWLRARTPSDIDGLGLSLANVRNRLERGNIEIALDQACGRGHFTPVGHLTLTAV
VDDEQHRDVSFDPVVNTAPGLSLHPRWLADLRARAYRQSRDGRDADE
Download sequence
Identical sequences A0A1X2LB28 A0A249BV42 H8IJ79 X8AIW9 X8CJ89
WP_014380750.1.33860 WP_014380750.1.3602 WP_014380750.1.37776 WP_014380750.1.53971 WP_014380750.1.69645 WP_014380750.1.8050 WP_014380750.1.85130 WP_014380750.1.89170 WP_014380750.1.95202 gi|379763260|ref|YP_005349657.1| gi|379748430|ref|YP_005339251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]