SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014410667.1.3533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014410667.1.3533
Domain Number 1 Region: 251-379
Classification Level Classification E-value
Superfamily DNA clamp 1.9e-26
Family DNA polymerase III, beta subunit 0.0048
Further Details:      
 
Domain Number 2 Region: 126-248
Classification Level Classification E-value
Superfamily DNA clamp 6.28e-23
Family DNA polymerase III, beta subunit 0.0033
Further Details:      
 
Domain Number 3 Region: 3-117
Classification Level Classification E-value
Superfamily DNA clamp 1.57e-20
Family DNA polymerase III, beta subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014410667.1.3533
Sequence length 379
Comment DNA polymerase III subunit beta [Rickettsia parkeri]; AA=GCF_000965145.1; RF=na; TAX=1359189; STAX=35792; NAME=Rickettsia parkeri str. Tate's Hell; strain=Tate's Hell; AL=Contig; RT=Major
Sequence
MLKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIAV
QVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMD
SINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIKDKEFCSASTDGHRLSIS
WVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLSSNKIKFICNENTSMLSKL
IDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIITVEKFRAVKLSLSRETLEISAVG
EARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKALKSDVVELYFSDVSAPV
LIKFPENPKDIFVVMPVKV
Download sequence
Identical sequences A0A0F3QM99
gi|383483923|ref|YP_005392836.1| WP_014410667.1.24793 WP_014410667.1.3533 WP_014410667.1.42246 WP_014410667.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]