SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014410990.1.3533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014410990.1.3533
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000000209
Family TTHA1013-like 0.051
Further Details:      
 
Domain Number 2 Region: 72-112
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000586
Family Omega transcriptional repressor 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014410990.1.3533
Sequence length 114
Comment toxin-antitoxin system HicB family antitoxin [Rickettsia parkeri]; AA=GCF_000965145.1; RF=na; TAX=1359189; STAX=35792; NAME=Rickettsia parkeri str. Tate's Hell; strain=Tate's Hell; AL=Contig; RT=Major
Sequence
MKTNDTFDGFTIELFKDTDGDWLARFEELPNVSAFGNSPEKALQELQQAWTLMKASYISH
NQSIPLAPSRKEYSGQFNVRVDKRVHRALVLEALRAKISLNALVSQKLTLSVKQ
Download sequence
Identical sequences A0A0F3QMM7
gi|383484390|ref|YP_005393303.1| WP_014410990.1.24793 WP_014410990.1.3533 WP_014410990.1.42246 WP_014410990.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]