SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014422854.1.95793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014422854.1.95793
Domain Number 1 Region: 23-529
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.56e-107
Family Pyridoxal-dependent decarboxylase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014422854.1.95793
Sequence length 558
Comment 2,4-diaminobutyrate decarboxylase [Marinobacter hydrocarbonoclasticus]; AA=GCF_000284615.1; RF=representative genome; TAX=1163748; STAX=2743; NAME=Marinobacter hydrocarbonoclasticus ATCC 49840; strain=ATCC 49840; AL=Complete Genome; RT=Major
Sequence
MTGKKKSAQASLEAMYRVFTVPEAPESTLSRIDQDISRNLAGFLQEHIVAIERDLSEVEK
DFSDYVIPEKPVFVSEQTQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPMERQVLGQIHRLVYQEDGSFYRKWMHDPRHALGAMCSGGTVANLTA
LWVARNRAFPAEGSFRGLHEEGLFRALKYYGHEGAAIVVSKRGHYSLRKAADVLGLGRDA
LVPVETDEFNRIQTDALRDKCLELQKQKIKIMAICGVAGTTETGNVDPLDAMADIAREFG
AHFHVDAAWGGPTLFSRTHKHLLRGIEKADSVTFDAHKQLYVPMGAGLVVFKDPGLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYEILIDQGIDKAKTFANM
IDEQPDFELVTRPELNILTYRYCPEDVRQALAMADELQAEKMNTCLNRITKFIQKTQRER
GKAFVSRTRLEPARYYHFPCIVFRVVLANPLTTPDILEDILREQRELSKEDGIADEIGIL
HQMAAAVLKQNQKEARQA
Download sequence
Identical sequences H8W7D9
gi|387815872|ref|YP_005431365.1| WP_014422854.1.95793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]