SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014424599.1.93961 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014424599.1.93961
Domain Number 1 Region: 1-379,558-699
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.01e-58
Family Phase 1 flagellin 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014424599.1.93961
Sequence length 699
Comment putative flagellin [Selenomonas ruminantium]; AA=GCF_000284095.1; RF=representative genome; TAX=927704; STAX=971; NAME=Selenomonas ruminantium subsp. lactilytica TAM6421; strain=TAM6421; AL=Complete Genome; RT=Major
Sequence
MAMTVKNNPTATLVLGELNKNVSKLGKQLSKVANGQKIVSVGDGTADYSISERMQAQIRS
LRQDIDNTKTGRSMLQVAEGGIQGIVDELREMKQLAINAANDSNTDADRATIQKEFDEKL
KQIDDIVATTNYNGKLLLNGEYGRWHTAMVTDNPNGSSNIVSTGVIEPSGTPITLASGNH
TITTAGVYVLGTGFTGDITIADGLSGVKITQSNSAQLTDVHIIGPTSGNANLWIEGLNIK
NTTDQSCIRFSGSDNVLSIKGNNNIDYSSYMASGSVSNEKATINVGGGLTIEGTGTLEMI
STHTYSAMIGTDNNEISNADLTINSGTYVLTGTDSRQNVLNSARAGAVIGSGICGSIGDI
TINGGTFDIFTSGDAAAIGSSMGVSYMINSGLAGGGDITIRNANITAVADGGACIGSGVD
NTIGNITIEDSIIHAENKALNHTVLANGIPWLQYLIGSGAGIGSGSYRYYSDGANAGDIV
IRNSEIFSSSNRGAGVGSGYKSYAKNITIENVTGQITSIKGEDIGKGLEGGVGTINISGY
PEPTLHETSISGTPLKIHTGTKANQRINCYIENLGTKALFNVKTDEELENLANVRTRASA
QRLLGSLTDPSVEGPLDKAINYALNEMTQVGSYINRLEQTENTLTVNHENTTSSESTIRD
ADMAKEMTEYTKSNVLAQAAQSMLAQANQNSSSVLSLLQ
Download sequence
Identical sequences I0GQX7
WP_014424599.1.93961 gi|383754284|ref|YP_005433187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]