SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014449848.1.71101 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014449848.1.71101
Domain Number 1 Region: 17-254
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-29
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014449848.1.71101
Sequence length 269
Comment proline dehydrogenase [Leptospirillum ferrooxidans]; AA=GCF_000284315.1; RF=representative genome; TAX=1162668; STAX=180; NAME=Leptospirillum ferrooxidans C2-3; strain=C2-3; AL=Complete Genome; RT=Major
Sequence
MSDSLFSKNIEMLYLAGETRQEALDRAKLLNKEGIGTILWPILSEENDSDGELFLKEIRE
LSHQMGLTMIRGGISFSLSQSGYPSSNGSMDHLRSAIAAAEDYSIGCWIDMEEGERVSET
METFLELRKKFAHLSITLQARLDRTEKDLETILNKRARVRLVKGQYPVSLESGSNDPDQI
RRKYLSYMEWLFSEGAMFAVATHDEEILQGASRLQNAHPRMMEFQMWLGMREDRIRSLLF
EGGFPVTLVLPYGPGARKHLKALQEIGKI
Download sequence
Identical sequences I0IQ14
WP_014449848.1.71101 gi|383784923|ref|YP_005469493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]