SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014456801.1.76488 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014456801.1.76488
Domain Number 1 Region: 62-411
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-63
Family Phosphate binding protein-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014456801.1.76488
Sequence length 418
Comment ABC transporter substrate-binding protein [Spirochaeta africana]; AA=GCF_000242595.2; RF=representative genome; TAX=889378; STAX=46355; NAME=Spirochaeta africana DSM 8902; strain=DSM 8902; AL=Complete Genome; RT=Major
Sequence
MKKFLLIATVLVISAVLVLPAFGAGQTERETHIRIMGYGGQDPAVVQRLLDEVIGQQLTE
ENIRLTYEPLEGDYNAAFFNALSAGTAGDIFYIPVETAPGIIATGQVLPLDDYVDTSPFI
DSLVETYTFDGRVYGIAKDFNTLAIHYNKDLFDEAGVEYPNAGDTWESLAEKARRVSDLG
ADVYGIAFPPAYDRFGAFAYATGWEPFDEQGNTNLLDPRFVSAVEWYTGLVADGVAVMPS
DIGQDWTGGAFATENVGMAIEGAWILGFLRNEAPNIQFGTTFMPIGPSGQRGNFLYTVAY
GINANSRNREAAIKVLEALTSPEAQQFILEEGLALPSREELADNPFLQGTHPEAVTNRVV
FQGAEDGNVLGAQYGTVGTDWFQPINAALGAIMSEDGDVQTELQRAQREIEALIERAR
Download sequence
Identical sequences H9UMS6
WP_014456801.1.76488 gi|383791952|ref|YP_005476526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]