SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014487938.1.89931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014487938.1.89931
Domain Number 1 Region: 191-372
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.18e-61
Family Methylesterase CheB, C-terminal domain 0.00000217
Further Details:      
 
Domain Number 2 Region: 4-110
Classification Level Classification E-value
Superfamily CheY-like 1.99e-25
Family CheY-related 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014487938.1.89931
Sequence length 377
Comment chemotaxis response regulator protein-glutamate methylesterase [Brachyspira intermedia]; AA=GCF_000223215.1; RF=na; TAX=1045858; STAX=84377; NAME=Brachyspira intermedia PWS/A; strain=PWS/A; AL=Complete Genome; RT=Major
Sequence
MATKIKVLAIDDSALIRQLLTKIVNSDPALEMVGTAANPILAENKVKNLKPDIITLDIEM
PEMDGITYLKKLMLNNPIPVIMFSSLLDKHRELALDALNIGAFDYVIKPSANVRDGVEEL
ATDLVEKIKNAYANRAKFYRKHGVTVPTEPAATTERSSISLEAPKTAGFKVYQKNTADII
LPLTPSRETPMDKIILIGSSTGGTEALIECLKNVTPSAPPIVIAQHMPEHFTTSFAKRLN
SILKIDVFESEDGMSVGRGQAVLARGAKHTMIKVRGGKYYIEVRDGEPVTRHKPSVDVLF
RSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQNEETCTVFGMPREAIARGGV
DEVLPLDKILAAALKRV
Download sequence
Identical sequences G0EQL1
gi|384208972|ref|YP_005594692.1| WP_014487938.1.89931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]