SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014496254.1.77977 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014496254.1.77977
Domain Number 1 Region: 94-163
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.22e-29
Family CO dehydrogenase ISP C-domain like 0.00017
Further Details:      
 
Domain Number 2 Region: 11-87
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014496254.1.77977
Sequence length 172
Comment (2Fe-2S)-binding protein [Bradyrhizobium japonicum]; AA=GCF_000284375.1; RF=representative genome; TAX=1037409; STAX=375; NAME=Bradyrhizobium japonicum USDA 6; strain=USDA 6; AL=Complete Genome; RT=Major
Sequence
MTRLEADRRHAVRFSLNGKPVEGEAEPRTLLSDFLRHQLGATGTHVGCEHGVCGACTIVV
DGMLTRSCLTLAAQVDGCELRTVEGLAPSADRLGVLQQAFRRNHALQCGFCTAGILMSLD
HYLAKNPAPTEAEIRDLLSGHICRCTGYTPIIQAALEAAAELASSKKETSDA
Download sequence
Identical sequences G7DNF4
WP_014496254.1.18950 WP_014496254.1.35620 WP_014496254.1.77977 WP_014496254.1.97209 gi|384219866|ref|YP_005611032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]