SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014496634.1.35620 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014496634.1.35620
Domain Number 1 Region: 95-161
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 4.06e-31
Family CO dehydrogenase ISP C-domain like 0.00036
Further Details:      
 
Domain Number 2 Region: 12-99
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.34e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014496634.1.35620
Sequence length 163
Comment (2Fe-2S)-binding protein [Bradyrhizobium japonicum]; AA=GCF_000472985.1; RF=na; TAX=1037409; STAX=375; NAME=Bradyrhizobium japonicum USDA 6; strain=USDA 6; AL=Scaffold; RT=Major
Sequence
MSDVTHEIPERIPVHIVVNGVGHTLDLMPWTTLLDALRDHLALTGTKKGCDHGQCGACTV
LIDGRRVNSCLTLAVMKDGAEITTIEGLAKDGTLHPVQQAFIDHDAFQCGYCTPGQICSA
AGLLAEGRARDADEIRELMSGNLCRCGAYPNIVSAIQQAMGRP
Download sequence
Identical sequences A0A023XHV4 G7DRS5
gi|384220247|ref|YP_005611413.1| WP_014496634.1.18950 WP_014496634.1.35620 WP_014496634.1.6944 WP_014496634.1.77977 WP_014496634.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]