SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014513101.1.27011 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014513101.1.27011
Domain Number 1 Region: 177-322
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 7.48e-46
Family Mevalonate 5-diphosphate decarboxylase 0.00049
Further Details:      
 
Domain Number 2 Region: 3-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-38
Family GHMP Kinase, N-terminal domain 0.0000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014513101.1.27011
Sequence length 325
Comment diphosphomevalonate decarboxylase [Sulfolobus islandicus]; AA=GCF_000189575.1; RF=na; TAX=930943; STAX=43080; NAME=Sulfolobus islandicus HVE10/4; strain=HVE10/4; AL=Complete Genome; RT=Major
Sequence
MLKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSDKNIVIVN
ERILPEDEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLNE
LLELELKPEELSKIARVGSGSGCRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELVD
IIPILSEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYLVMR
HSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAGYTFDAGPNPHIFTTERYVQDILE
FLKSLEIKRIIVSKVGDGPKILNRE
Download sequence
Identical sequences F0NLF3 M9UHE2
WP_014513101.1.27011 WP_014513101.1.91160 gi|385774291|ref|YP_005646858.1| gi|479326600|ref|YP_007866657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]