SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014553728.1.13558 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014553728.1.13558
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 6.28e-24
Family YheA-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014553728.1.13558
Sequence length 133
Comment hypothetical protein [Halanaerobium praevalens]; AA=GCF_000165465.1; RF=representative genome; TAX=572479; STAX=2331; NAME=Halanaerobium praevalens DSM 2228; strain=DSM 2228; AL=Complete Genome; RT=Major
Sequence
MSVEAIARRLKKKLKNSQEYQNYLELREKIMEKEGSKKMLLDYQNLMMKMQTKRMSGEEL
TEADKDKLQNLQNFIEINNNVKKYLEAEYALSQMINKIQKIIFSDIKVGISESELKHKQK
QENDSESEVKSES
Download sequence
Identical sequences E3DPE6
gi|385800464|ref|YP_005836868.1| WP_014553728.1.13558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]