SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014555400.1.96088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014555400.1.96088
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.58e-31
Family GHMP Kinase, N-terminal domain 0.00095
Further Details:      
 
Domain Number 2 Region: 173-318
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 7.19e-29
Family Mevalonate 5-diphosphate decarboxylase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014555400.1.96088
Sequence length 324
Comment diphosphomevalonate decarboxylase [Haloquadratum walsbyi]; AA=GCF_000237865.1; RF=representative genome; TAX=768065; STAX=293091; NAME=Haloquadratum walsbyi C23; AL=Complete Genome; RT=Major
Sequence
MKATARAHPIQGLIKYHGMRDSDKRYPYHDSISVCTAPSATTTTVEFQSDASGDVYIIDN
ERVEGRAAERIDAVVEHVRERTGIRDPVRLVSTNSFPSNIGFGSSSSGFAAAAMALVTAA
GEELTHPEISTIARRGSSSAARAVTGAFSQLYSGMNDTDCHAERIETDLDATVRTVAAHV
PAYKETEEAHREAAQSHMFDARLAHVHHQIDAMRDALYDADFDRIFELAEHDSLSLTAAT
MTGPAGWVYWQPQTIAVFNTVRELRERESIPVYFSTDTGASVYVNTTAAHVDTVESAISD
IGIDTDIWTVGGPATVLSASDSLF
Download sequence
Identical sequences G0LGL3
gi|385802924|ref|YP_005839324.1| WP_014555400.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]