SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014555608.1.96088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014555608.1.96088
Domain Number - Region: 168-231
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000883
Family Middle domain of MutM-like DNA repair proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014555608.1.96088
Sequence length 719
Comment hypothetical protein [Haloquadratum walsbyi]; AA=GCF_000237865.1; RF=representative genome; TAX=768065; STAX=293091; NAME=Haloquadratum walsbyi C23; AL=Complete Genome; RT=Major
Sequence
MDPKQELTSVDIAALVTELRRYTGAKVDKTYRYGDDLLRFRMRDFDRGRLELLIEVGTQK
RIHTADPDHVPDAPERPPNFAMMLRNRLSGADLVNVEQFEFDRIMILSFERGEEMTRIIV
ELFGDGNVAVVDSAGEVIQSLETVRLKSRTVAPGAQYEFPDSRVNPLQVTYDRFVSLMNE
SDTDIVRTLATQLNLGGLYAEEVCARAGIDKTTQITNTSDKIYRAIYTALESLGTQLQSG
DFEPRLYADDDAVIDATPFPLEERKQQNLDVTAYDSFNGALDVYFREVDRNPAAEESGQT
RPDFAAEIAKKQRIIEQQEGAIDDFEQRAEAERSRAELLYANYELVNEIIETIQTARAED
TSWDEIRETFAMGAERGIDAAAAVVSVDGAEAMVTIEIDDVRVPVNVDVGVEKNADQRYT
EAKRIEEKKEGALTAIENTREELNAVKQRRDAWDREDAKPDTEDNADNTETVTDKVNTGT
EPSRMGPTNDEWLSMTSIPLQKNDDWYEQFRWFHTSTGYLVVGGRNADQNETLVKKYLNK
HDRFFHTEAHGGPITILKASGPSEPAEPIELTAETRREVAQFAISYSSIWKEGRYADDAY
VVTPDQVSKTPESGEYIEKGSFVIRGDRTYIRDVAAEIAVGIQCADETQVIGGPPSAIAD
RVPTMVQVRPGRYAQNDAAKLAYREFRNRFADESFVRKIASPDKIQEFLPPGGSDLVDE
Download sequence
Identical sequences G0LID2
gi|385803199|ref|YP_005839599.1| WP_014555608.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]