SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014556395.1.96088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014556395.1.96088
Domain Number 1 Region: 19-82
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000112
Family Heme-binding PAS domain 0.064
Further Details:      
 
Weak hits

Sequence:  WP_014556395.1.96088
Domain Number - Region: 311-407
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00426
Family Histidine kinase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014556395.1.96088
Sequence length 411
Comment histidine kinase [Haloquadratum walsbyi]; AA=GCF_000237865.1; RF=representative genome; TAX=768065; STAX=293091; NAME=Haloquadratum walsbyi C23; AL=Complete Genome; RT=Major
Sequence
MSRESDQSSISAAENNHLSRITDPVFAINTDFEITYANPTMEAVFGSDRLTGRSLTDIVA
SGQENRLYIACETASKHQNPIQIQISSHALVDPDISSIAVTDIPDTAYHARIFPSETGVT
VYLFGYMNSTSTDTNAKINTSTSTSTSTTESSQQESSTGATHVRDHLVFMNQIIRHDLLN
GLNVISARADILSEFVESVGESHLETVNSRVNEMVTLLEVMQSITDIKLEDNTHSHSPQS
LQKAVQTAIDALDTRYRERITVSGSVPDVTVQADEHLSKVFSNLFASILRGEDGVSTAES
AITINAYTQNDPNRLEAPLQTDVHNNSVDHDQDDSIATTAVITITSSKGSISIKAQQHLT
ATDINNLASPDDGFGLYLVGRLIDSYDGSVLVNQESENEKTIITVVLLQTD
Download sequence
Identical sequences G0LJF4
gi|385804125|ref|YP_005840525.1| WP_014556395.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]