SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014556972.1.96088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014556972.1.96088
Domain Number 1 Region: 299-615
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 1.86e-73
Family RNA-polymerase beta-prime 0.0000131
Further Details:      
 
Domain Number 2 Region: 89-212,263-302
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.65e-27
Family Intein (protein splicing domain) 0.02
Further Details:      
 
Domain Number 3 Region: 34-102
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0000000000778
Family RNA-polymerase beta-prime 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014556972.1.96088
Sequence length 637
Comment intein-containing DNA-directed RNA polymerase subunit A'' [Haloquadratum walsbyi]; AA=GCF_000237865.1; RF=representative genome; TAX=768065; STAX=293091; NAME=Haloquadratum walsbyi C23; AL=Complete Genome; RT=Major
Sequence
MTETITDASEYEHITDDIAAIVDDYNLPESLQHRIYETIEERGEVPTEKVDDIAQAIASR
YEDSRVDAHDPVGTVSAQSIGEPGTQMSIEADESIVIRRDGETELTEIGSFVDTILTADN
QETRITDGHEIALAPNGLEVPSLDTDEQIRWKHIEAVSRHASPDEILLIELESGRSIRAT
KAHSFVTRRDGDVLPVAGETLVMGDVLPTVGSYDHASGSISVPLQSQSVAADGGTVEPNT
NITANAERDSTSITSAGIIGSATWERISSIETVAPEYEYVYDLSVSGLETFTTGEGVVTH
NTMNTFHYAGVAEIDVTQGLPRLIELVDARKTPDTPTMTVYLEEEYANERPRAHEVVWQM
EATKILALGDISTNVADMLVQVDLNAETLNERWPTIGDADLIAEEVQDIIENNLGVSTRR
EKMLIEFGPSEPSYRRLLQLVEELRDIVFKGLEDISRVVIRKEDNERTNGEEFVLYTEGS
ALGDVLPIEGVDASRTTSNNIHEVHRNLGIEAARESIINETMETLREQGLDDVNVRHLML
VADIMTNRGEIESIGRHGISGSKDSVLARAAFEVTVNHLLDAAVHGEEDDLEGVIENVIV
GKPVAIGTGDVDLRMGSIDADSGRSANSGGPPELSDD
Download sequence
Identical sequences G0LF89
WP_014556972.1.96088 gi|385804831|ref|YP_005841231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]