SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014558886.1.81480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014558886.1.81480
Domain Number 1 Region: 125-224,375-450
Classification Level Classification E-value
Superfamily TrmE connector domain 1.19e-46
Family TrmE connector domain 0.0015
Further Details:      
 
Domain Number 2 Region: 105-156,192-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-42
Family G proteins 0.0000845
Further Details:      
 
Domain Number 3 Region: 4-124
Classification Level Classification E-value
Superfamily Folate-binding domain 1.02e-35
Family TrmE formyl-THF-binding domain 0.0000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014558886.1.81480
Sequence length 450
Comment tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE [Ignavibacterium album]; AA=GCF_000258405.1; RF=representative genome; TAX=945713; STAX=591197; NAME=Ignavibacterium album JCM 16511; strain=JCM 16511; AL=Complete Genome; RT=Major
Sequence
MKEDTIIALATPPGVGAISVLRISGPSSFILTDMLFRGNTKINDSPGYRIYYGDLVDSNE
NHIDDVLVSVFRAPNSYTGEDSVEISTHGNPLIAQKIIGEFLKLGKIRLAEPGEFTKRAF
LNNKIDLSQAEAVADIIHARSEASLRGARNQLDGLLSKKVGKLRESLVNATSFVELELDF
AEEDIEFVNTEELLKRIDEIIIEIDSLLETYNIGRVIRDGVNVALVGKPNVGKSSILNYF
LKESRSIVSEIPGTTRDIIREEISIEGILFRLYDTAGLRDSDNPIEEEGIKRSREVLRNA
DIILFIEDTQQGIAQDLLEELMNISSGDKIIRVINKIDLVDKNNSDANVKISAKTGQGMN
ELLKILVQKAIGMEYYTEKTAIVTNLRHYSCLKKARESLLNARDSVIKKNSGEFISVDLR
NASISLGEIIGEVTTDDILNNIFMKFCIGK
Download sequence
Identical sequences I0AFG9
gi|385808598|ref|YP_005844994.1| WP_014558886.1.81480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]