SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014559517.1.81480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014559517.1.81480
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily Folate-binding domain 1.18e-98
Family Aminomethyltransferase folate-binding domain 0.0000000962
Further Details:      
 
Domain Number 2 Region: 275-358
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 6.05e-22
Family Aminomethyltransferase beta-barrel domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014559517.1.81480
Sequence length 359
Comment glycine cleavage system protein T [Ignavibacterium album]; AA=GCF_000258405.1; RF=representative genome; TAX=945713; STAX=591197; NAME=Ignavibacterium album JCM 16511; strain=JCM 16511; AL=Complete Genome; RT=Major
Sequence
MKRTKLYNIHKNLNAKIVEFAGFEMPIQYSSIIQEHKAVRHNVGVFDVSHMGEIFIRGKQ
ALDFVQYITVNDASKLFPGRVQYSAMCYEDGGIVDDLLVYKISDEEFLLVINASNILKDF
EWMNKNNKFSVEIINRSDDFSLLAVQGPDSLKTIQKIADKEIDLEYYHFTKMKIANVEMI
VSRTGYTGELGYELYFEGDEATAEKVWNAVFEAGKEFNIQPVGLGARDTLRLEMGYCLYG
NDIDQTTNPLEAGLGWITKLNKSDFVGKDALLKAKENITRKLVAMISEEKTFPRHGYDIS
ANRKKIGHITSGTVSPILDKPIALGFVEKDFSAVGTEVNFVVRGKEFPAKIVKLPFIKK
Download sequence
Identical sequences I0AHA2
WP_014559517.1.81480 gi|385809231|ref|YP_005845627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]