SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014569584.1.63053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014569584.1.63053
Domain Number 1 Region: 202-589
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.42e-88
Family beta-Lactamase/D-ala carboxypeptidase 0.000000695
Further Details:      
 
Domain Number 2 Region: 66-249
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.09e-41
Family Penicillin binding protein dimerisation domain 0.0000374
Further Details:      
 
Domain Number 3 Region: 599-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0066
Further Details:      
 
Domain Number 4 Region: 659-702
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014569584.1.63053
Sequence length 714
Comment penicillin-binding protein 2B [Lactobacillus rhamnosus]; AA=GCF_002103145.1; RF=na; TAX=47715; STAX=47715; NAME=Lactobacillus rhamnosus; strain=Lrh39; AL=Scaffold; RT=Major
Sequence
MKIFKSKRSTNAHPARNRKFFGIGLIGFTLLVLGGFVLRFSFVATIGEVDSNNLAKQRQK
QYQTDTVLQAQRGAILDRSGNVIAEDSNTYTIYAILDKQNKNGDKPDYVTNKAKTAKILS
RYLAIGEDKVLARLNPSKNLFQVEFGRPGTKLSLAIKKQIEAEKLPGIHFRETPSRLYPN
GVFASHVIGLAQAQDNGGGLTGVMGLEKQFNTVLTGTNGYRRSETDAYGYKLPNAKTKAK
APVNGGSVYTTLDSGLQAYLETLMTDVQTKYEPKGMTAVLMNAKTGRILAATQRPTFDAS
TGEGLGDMWRDSLVEDNYEPGSVMKIMTLAAAIQSGKYHPNEYFQSGSVKLDGGTVNDWR
TGGWGSIPLSKAFPLSSNVGMVKIEQEMGAGIWKSYLDKFKFGQKTGITLPGETSGRISF
QRPLDQAITAFGQGIEVNVMQMMQAISAVANDGKMLKPQIVSKVVNKNGKATVYKPEVVG
QPISKETAAQVIDAMRHVVNDEDGTGVAYKMPGVDLAVKTGTGQIASAQGGYLTGDSNYT
FSVAGIAPASNSKYVLYVAMKQPQKMTEPAESILASIFKPMMQRALDTTANSTVSGETNT
AEVPAVTNAALASAQDTVKKAGFDVATIGTGNKIVQQLPASGTKALRDSRVLLLTNGAMT
MPDLTGWSKSDVLKFVQLTGKKFKLVGDGFVVRQSIAKGTLLGNASGTIEFKQQ
Download sequence
Identical sequences A0A1Y0DTI3
WP_014569584.1.100 WP_014569584.1.100405 WP_014569584.1.101629 WP_014569584.1.14484 WP_014569584.1.15430 WP_014569584.1.23805 WP_014569584.1.33665 WP_014569584.1.36475 WP_014569584.1.57253 WP_014569584.1.62246 WP_014569584.1.62275 WP_014569584.1.62506 WP_014569584.1.63053 WP_014569584.1.63979 WP_014569584.1.67395 WP_014569584.1.70398 WP_014569584.1.73229 WP_014569584.1.7391 WP_014569584.1.8195 WP_014569584.1.95170 WP_014569584.1.9713 gi|258508275|ref|YP_003171026.1| gi|258508275|ref|YP_003171026.1| 568703.LGG_01280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]