SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014579713.1.28423 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014579713.1.28423
Domain Number 1 Region: 110-301,387-537
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.19e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000108
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-19
Family Anticodon-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 284-400
Classification Level Classification E-value
Superfamily GAD domain-like 0.000000000105
Family GAD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014579713.1.28423
Sequence length 567
Comment aspartate--tRNA ligase [Mycoplasma hyopneumoniae]; AA=GCF_000183185.1; RF=na; TAX=907287; STAX=2099; NAME=Mycoplasma hyopneumoniae 168; strain=168; AL=Complete Genome; RT=Major
Sequence
MHNSKTLSKSDLGKTVTIQGWVQNIRKIKGKSFVIIRDYQGIFQAVVTQNSKVDRFTKES
VVKVQGILTQRINPNTKIHNGDLEILVDNLETISLADQIPFEISDQLEVSEDLRLQFRYL
DLRRQIMKENLTFRYKIFHYIRCFLYKNNFIEIETPILSKSTPEGARSFLVPTRQKGKFF
ALPQSPQIYKQLLMVSAFEKYFQFARVFRDEDLRKDRQFEFLQLDLEFGFPTFEKISEEI
EALIRDLWTKIFPNLVIDFPKLTYFEAIKNYGTDKPDLRFETKLFDLDFLNDIDLLFQGK
VRGLFLEKVLITKPEYRIFVEKIQQNNAKTLLYLHIFEGKITYFSFKTSEKLLIKTKIEN
WILQNNYHTGTLFLIAADYKIASQALGALRNLVAKKYKLINEDQFKFAWIINWPLFELDI
NNKLTSAHHPFTAPTLESQQFLHKNPLKVQAQAYDLVLNGFELGSGSIRIHNVELQKQVF
TILGLDQDQIHTQFGALLRAFNYGVPPHGGFAFGLDRLIMILRKTNSIRDVIAFPVNSKG
LDLLLDSPTEIDQNLLAEFGLKDIGKN
Download sequence
Identical sequences E4QSR4
gi|385334416|ref|YP_005888363.1| gi|507382683|ref|YP_008025685.1| WP_014579713.1.28423 WP_014579713.1.29754 WP_014579713.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]