SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014592555.1.31851 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014592555.1.31851
Domain Number 1 Region: 82-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000248
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014592555.1.31851
Sequence length 145
Comment hypothetical protein [Pseudomonas putida]; AA=GCF_001282125.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=PCL1760; AL=Contig; RT=Major
Sequence
MEMQWWIWLVFGIALILLELVLPTFFILWFGIGAVLVSLISLAAPSLQLDMQVLLWVLLS
SATTVLWFKVFRRKQPDVRWTADSVIGEVGLLTAPVSEFQKGRVRFQKPILGNEEWTCVA
DSQIAVGERVRLTAIEGNTARVIRA
Download sequence
Identical sequences A0A0A7PVV3
gi|386014109|ref|YP_005932386.1| WP_014592555.1.31851 WP_014592555.1.34900 WP_014592555.1.42045 WP_014592555.1.47320 WP_014592555.1.48025 WP_014592555.1.62773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]