SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014600186.1.91857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014600186.1.91857
Domain Number 1 Region: 490-664
Classification Level Classification E-value
Superfamily Fibronectin type III 7.87e-16
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 2 Region: 321-478
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000178
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014600186.1.91857
Sequence length 1039
Comment tenascin-R TN-R; restriction; flags: Precursor [Paenibacillus polymyxa]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MKIKKHLSTLLVTSLLVGGFIGFGIKTEASGSFNTKYQLLSPGEVNLYWDQQPISGNYWI
YRDNVLLGKVPAGYVPSFWDEEATPGTHVYRIDAIDTVTGTKLIDSESITVNTKEADEAL
PTSFKIGNRTASVNASFVKIGGVVFRPLADNYLISSKAVVESNWLPSNWKKNDFSNSGLD
KKIENTWLPTLNDTEYESLKVTSYSAPGWEGNLITNPIVDERAVPPTMKELLKYSSLYDI
PTENLNAGQFVRDKMFNNSITYVYGSSDNIHKIRVHRSTSSSFPTALVITLKSSTKLSGE
GTSRNPYTISSVGPENPSLQTPNGLKLVSSKAGHTSFSWDIVEKATSYIVKRDGIDIGTV
STTVFEDSSTVAGSSYNYTITAKGTDGSSSQESASLKIDVQAPPVLKAPANFKELGKTHN
SVLLGWDAVVGATSYQLTSDGSVAYEGSNTQINISSLSPGDYTFKVKAISDGISGPESIV
KVSIKENTLDYPIGLSVTNATYNTISLKWNSVNGAESYIIQRDGVEVGRTTNTNFSDENV
QPGAQYDYGVMAINGSIKSENSKLTVTVPTKPIEGLAPGIPSGFKVTRAYADKVKLQWAT
VSDATYYDLIRDSGTLVYRGPLTAITDETTGPEESYTYHIIAANQFGKSLPSSTIAVTTP
AEAPAIVVSPSPVVEGTITFKFNMVEGAQSYKVERNPEVTYDNNGNGTFHLTYFNTVTGE
TRDYGNVTPIDNKLPFYETGVDPGKDYHYEITAIRMSSLGIPEVIGKSEVSINTPSDGSG
VTIPAEEDSTQDKPGDKSKSKKNKDSHEDVISNNSTGKAITGSSGSTLSSVKNSISPDSS
KRFAEITNAPQSTVSESTYMFTDLTGNFAEQAVYSLAKHGTIIGYEDGTFGPDKKISRAE
FAIMLTRAMKYSSDEGYVNNFKDFDMNTWYSKELAVALNNKVTKGFDKDTYKPNSLIPRE
QAAVMVANIMRTKMADNGNEILYTDKNNIIDWARSDVLFTSSLDIFNGYSDGTFLPKRQI
TRAEAAVVIYRMLSKINNK
Download sequence
Identical sequences WP_014600186.1.13814 WP_014600186.1.91857 gi|386038122|ref|YP_005960998.1| gi|386038122|ref|YP_005960998.1|NC_017543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]