SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014627186.1.70206 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014627186.1.70206
Domain Number 1 Region: 14-155
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000732
Family MarR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014627186.1.70206
Sequence length 160
Comment hypothetical protein [Streptomyces cattleya]; AA=GCF_000240165.1; RF=representative genome; TAX=1003195; STAX=29303; NAME=Streptomyces cattleya NRRL 8057 = DSM 46488; strain=DSM 46488; AL=Complete Genome; RT=Major
Sequence
MIRTTIDQAPADPTATDDMLTTQPIGYWSGLAHTAVTRQLRDAMAKIDITQPQYWVLNRV
KYAPAAPSRTEVVDQLTPLADGQHEIPRVLGQLLHRGWLRTDADQRLHLTDAGETARVHV
RELVTELRALVHEGISDEEYVAALKVLRRMIANVEGSRNA
Download sequence
Identical sequences G8WVS9
WP_014627186.1.28582 WP_014627186.1.70206 gi|386353650|ref|YP_006051896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]