SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014671369.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014671369.1.57224
Domain Number - Region: 26-128
Classification Level Classification E-value
Superfamily TPR-like 0.00223
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014671369.1.57224
Sequence length 170
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MAERQEQAAPDAVLTRIGQVVMLHHGGDREEARSRFLDLWAEVGEEGDPLHRCTLAHYLA
DTQDDPADELAWDLRALSAAEEAADGRVGADPSNVRGFFPSLHLNLAADYAKLGRAEAAR
SHLRRARSAARCLADDGYGAGVRSEISRLALRLGEDGTPGEEGWRPPRQG
Download sequence
Identical sequences H2K564
gi|474981053|ref|YP_007691519.1| WP_014671369.1.21199 WP_014671369.1.57224 gi|386838844|ref|YP_006243902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]