SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014672312.1.28171 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014672312.1.28171
Domain Number 1 Region: 44-168
Classification Level Classification E-value
Superfamily TPR-like 0.000019
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014672312.1.28171
Sequence length 172
Comment MULTISPECIES: hypothetical protein [Streptomyces]; AA=GCF_001514055.1; RF=na; TAX=1903; STAX=1903; NAME=Streptomyces corchorusii; strain=DSM 40340; AL=Scaffold; RT=Major
Sequence
MCEGDAVNQNWEDRVAAAWAAFDTYPEERAHEFRALIDTLVAELPDDSPLGPFEQACAWD
STGHSDKAVPLYREALARGLDGYKGRRAKIQLSSSLRNTGRAEEGVELLTPELDAPSDEL
DDAVRATLALCLSSLGRDREGLSLVLGALAPHLPRYQRSMANYARALVEPGV
Download sequence
Identical sequences A0A117QFT5 H2JYK9
gi|386839795|ref|YP_006244853.1| WP_014672312.1.28171 gi|474982006|ref|YP_007692472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]