SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014673557.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014673557.1.21199
Domain Number 1 Region: 85-247
Classification Level Classification E-value
Superfamily TPR-like 2.68e-33
Family BTAD-like 0.00028
Further Details:      
 
Domain Number 2 Region: 294-553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-20
Family Extended AAA-ATPase domain 0.088
Further Details:      
 
Domain Number 3 Region: 877-989
Classification Level Classification E-value
Superfamily TPR-like 0.000000000335
Family Tetratricopeptide repeat (TPR) 0.089
Further Details:      
 
Domain Number 4 Region: 9-82
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000283
Family PhoB-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014673557.1.21199
Sequence length 1132
Comment AfsR family transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MTQAADDQGTPVPIGGRRLRTLLAALALRPGRTTAPRTLVEEIWADDPPQDAPAALQALV
GRLRRTLGRHTIASTPGGYRLEAAEDEVDLHVFERLAHTGTQALTAGDPATAHRALTQAL
ALWYGPALADLPDRTAAARPEALRLEAARARAAASLALGRAREAVPELRELTTVHPYDEA
LHALLIRALRDTGRPADALAAYESARRTLADSLGTDPGPELQSLHTSLLKPEPLDAPGYQ
ETAKPTHAPEHLEPPKPAYAPEYLESPKPAHTSWHPAHPAYPAPPKPPGRTGNLRPRLTS
FVGREPELKAIRSDVHRARLVTLTGPGGSGKTRLAEEAAAPLPSAWLVELAPLDRPEAVP
GAVVSALGLRETVLLTNELATPQADPTALLIEYCAPRSHLLILDNCEHVIGAAAALAETL
LTHCPGLTILATSREPLGVPGESVRPVEPLVPEQAHRLFTERAKAVRPDADAVLGDTEAV
AEICRRLDGLPLAIELAAARLRLLTPRQIADRLDDRFRLLTSGSRTVLPRQQTLRAVVDW
SWELLDERERTVLREVSVFAGGWDLAAAEAVCTGPAADLIGALVDKSLVVAAPHDPDGTG
AGMRYRMLETIHEYATERAAEVPGLRAAAERRHRAWVRALVEEAEPRLRSAAQLPWIARL
ETELDNIRAALDRAVRAGDEAEAGAVVLATGWFWWLRNHRQEAVAWVRLVLRLGIALDTL
PAGAPADEVRARAKTADPVGAFLAAPDGEAGHPLRELRMDLRMLDLFLTAETGTESLAAD
ERTREYLARVRAAYEGGGPQAARLPGIIWPLTSYYLGGPTDIGPQMTQCVANCRRYGGDW
ELGVALMYRAHVTVDSPGNLRGVDEDLAELRTLGRRVGDRWMRAQICSATGEAAMVRGRY
EEARGEYEEALRLAYEVGAYAESPFLIARLAEISYRSGDREAALAALDEAGTAADRYAVP
ESRAFVLLLRAHIALHDNQHAQARELYEATRAVIRDGTPPPQFVAAQRMAEALIEAHGSG
PAHGLPILAKALREAVDHRCAESITAGLVDVAAGLLARLGDLPGALRLFAAADHWRDGLD
RPEPERGEAARVRATARAALPADRYAAECARGASFGVADVLRELGAGTATGR
Download sequence
Identical sequences H2JYS1
gi|474983259|ref|YP_007693725.1| gi|386841048|ref|YP_006246106.1| WP_014673557.1.21199 WP_014673557.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]