SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014674794.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014674794.1.21199
Domain Number - Region: 162-220
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 0.062
Family Nickel-iron hydrogenase, large subunit 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014674794.1.21199
Sequence length 288
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MSHPYLPPPYPPSEDRSAELRRRFAEEARSERPDLSALCLLIGAVTDGSLDEAGIDAAQA
ELDRLAGELPFRPGGPRAWAEAVRELLGTRHAFHGTPGDYQRLESSLLHEVLRRRRGLPI
LLSVVWLEVARRAGAPVYGVALPGHFVVGFGAAAEQVLADPFDGGRVLTGPDADLLVVGA
TGTPLDPSMLEPAPPLEVVQRVLNNIRAWAAARPERSDVALRAVELALLIPSHPARLRYE
RGQLLVQRGEFVAGAEELQHYADLIEVVDESAARKVRQEARTARSKLN
Download sequence
Identical sequences A0A0S2P5A0 H2K0H2
gi|474984525|ref|YP_007694991.1| WP_014674794.1.21199 WP_014674794.1.57224 WP_014674794.1.88765 gi|386842315|ref|YP_006247373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]