SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014676163.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014676163.1.21199
Domain Number - Region: 126-193
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000111
Family PriA-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014676163.1.21199
Sequence length 335
Comment ATP-dependent DNA ligase [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MELEVAGRTVRLSSPDKVFFPERGFTKLDLARYYAAVGPGILRALRNRPTTLERYPDGVG
GEWFYQKRAPKGMPGWIPTAHITFPSGRSADEMCPTEEAAVVWAAQYGTLTFHPWPVRAT
DVDHPDELRIDLDPQPGTDYADAARAARELRAVLDEFGGLRGWPKTSGGRGLHVFVPIEP
RWTFTQVRRAAIAVGREMERRMPDRVTIKWWKEERGSRIFLDYNQTARDRTIASAYSVRP
RPHAPVSAPLRWEEVGVAEPRDFDLATMPARFTDLGDVHADMDDHAFSLDTLLELARQDE
HDHGLGDLPYPPEYPKMPGEPKRVQPSRARREPSP
Download sequence
Identical sequences H2JQM4
WP_014676163.1.21199 WP_014676163.1.57224 gi|386843693|ref|YP_006248751.1| gi|474985902|ref|YP_007696368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]