SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014677193.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014677193.1.21199
Domain Number 1 Region: 200-350
Classification Level Classification E-value
Superfamily TPR-like 6.9e-23
Family BTAD-like 0.0024
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000177
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0066
Further Details:      
 
Domain Number 3 Region: 106-194
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000221
Family PhoB-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014677193.1.21199
Sequence length 360
Comment transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MAMPTTTAGRCDRGVTGLTAEEREVLYALGCGLGNAEIAATLVLPEQVVAERLGRVLEKL
GLRDRAAAIVHAFDCGLVVPGQGPRRPEPGNSAARRTGTASGPWLSVSVLGPLRTTLAGR
PVDVGPVRQQAVLAALALSPRRSVSRRRLLEDVWGREMPDGNVVPVYVYRLRKSLRLGER
PDSVIRRDRYGYGLVQGIAEVDALCVDDLVTRAEEAERTGDLPGAVRLCAQALELFRGEP
LAGLPGPFAEAERVRLAQRRVGLAQRKADWQLRLGRRLEAITALSALALEEPLNEPVAAM
LMHALRRDGRRAEALAVFDRIARRLGDDLGVAPGDLLVRARRAALLGEDAGPGRGRAGAA
Download sequence
Identical sequences H2JL25
gi|386844727|ref|YP_006249785.1| gi|474986937|ref|YP_007697403.1| WP_014677193.1.21199 WP_014677193.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]