SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014679840.1.74489 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014679840.1.74489
Domain Number 1 Region: 679-957,986-1096
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.52e-24
Family alpha-mannosidase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 281-431
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000434
Family alpha-mannosidase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014679840.1.74489
Sequence length 1107
Comment glycoside hydrolase, partial [Solitalea canadensis]; AA=GCF_000242635.2; RF=representative genome; TAX=929556; STAX=995; NAME=Solitalea canadensis DSM 3403; strain=DSM 3403; AL=Complete Genome; RT=Major
Sequence
MRKVILSLFVIVLTVRSYAQLTVPYFGKIEWINGYAKEIKGENINYDSAYPEYATTALLT
RCTDGKKEIVWETAPVPQKIKGKYIYFSWVAAHSSGTSAGTRYFDLYLNDEKLLTFTTQP
AHQTPDWKFVAADSSALVFHQTKRDGASDAHGLAFLRLPLSKVKPGMPVKLKIVGQAEKS
NDWYMTFKFSFEEKADVYPRPFLLKDQQQIIALTALHFGKEEQLHVKINNKELPPFRLQN
GVNKFDIPVNAVQKEDSVMLRVAFGSKVLINKFVQLKPVKYRVLHFIHHSHTDIGYSHLQ
PEVLKIHLKNIDDALQMIESTRNLPKEAQFKWNIESLWAVENYMKQASPLQKEKFIAAVK
EGSICLSALYANILTGLSQPEEMFHYTDYADKLRKEYGVTINSAMISDVPGFAWTTVTAL
AKGGVRYFSSGPNFLGESHPYWGDRAGHFVKTWGDKPVWWVSPSGDEKVLFWTGAKGYSS
WHGVAPGGVFERGPGKIASYLNELDKNNYPYEMVQWRYNCVADNGPIDTAISRFVDQWNK
KYASPKIVLNTTDKLFEEFEQKYGTQLQQVKGDITPYWEDGAASTAAEEGKNRVNSLRLQ
QLTTLYAMLNPSQYNQERFYEAWKNVIMFHEHTWGAHNSISQPDVSFVTEQWRIKKQFML
DADEEINGLEKELLQPFSNIKSKKIAVLNTLSWKRSGPVKLSADVSAKSVKDGSGKLLPL
QKLKDGSYVFIAQDVPPLGTAIYELTNAEAPIAPTPFILTDNSLSNGKVSVQWDKTNGSL
LNLNLGTDFNYAGDFSKQGLNSYWYVPGLNPADAETNGSVQLQVLENGPVLKTISLISDA
PGANKLERRMNLYAGSQEVAIENIVDKKAIRNKEAVHFGFPFNETLCKTIIDVGYGSMQY
ITDQLPGSNMDYLYGRRWLDVNTSDRGVQWMLLEAPLVEPGNMIDERLVVPPSHKEWKKE
GKPTATWFSYVMNNYWHTNYKADQEGIARFRYALRPHGKFSYSETEKMGSEFTQPLVALP
VNESMGLKGGLFALSNNRIVVTSITPQQDGSFLIRLYNPESSSEQTKIQWQNLKPSQFIN
TNTGKTFQHNEAISLSGMGVLELRTIK
Download sequence
Identical sequences H8KTN8
gi|387790724|ref|YP_006255789.1| WP_014679840.1.74489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]